Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdkn3 Peptide - N-terminal region

Cdkn3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410006H10Rik

UniProt

Q810P3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdkn3 Rabbit Polyclonal Antibody (orb582156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082498

Preservative

Lyophilized powder

AA Sequence

LKSYGIQDVFVFCTRGELSKYRVPNLLDLYQQYGIVTHHHPIPDGGTPDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2B4 Rabbit Polyclonal Antibody
TA375797 100 µL

EIF2B4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Artery: carotid
CS701712 5x 5 µm

Tissue FFPE Sections, Artery: carotid

Sign In for Pricing
View Details
Tmem67 Mouse Gene Knockout Kit (CRISPR)
KN517892 1 Kit

Tmem67 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
QKI-6 Recombinant Chimeric Antibody Antibody
HA610332 100 µL

QKI-6 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
PerCP Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331F-01 50 Tests

PerCP Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
PerCP Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331F-02 100 Tests

PerCP Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details