Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDR2L Peptide - C-terminal region

CDR2L Peptide - C-terminal region

Product Specifications

Product Name Alternative

HUMPPA

UniProt

Q86X02

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDR2L Rabbit Polyclonal Antibody (orb324524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055418

Preservative

Lyophilized powder

AA Sequence

VQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRF2 Polyclonal Antibody
E-AB-93081-01 60 µL

NRF2 Polyclonal Antibody

Sign In for Pricing
View Details
NRF2 Polyclonal Antibody
E-AB-93081-02 120 µL

NRF2 Polyclonal Antibody

Sign In for Pricing
View Details
NRF2 Polyclonal Antibody
E-AB-93081-03 200 µL

NRF2 Polyclonal Antibody

Sign In for Pricing
View Details
Biguanide Hydrochloride
TRC-B016556-2.5G 2.5 g

Biguanide Hydrochloride

Sign In for Pricing
View Details
DHLAG (CD74) Human qPCR Primer Pair (NM_004355)
HP227501 200 Reactions

DHLAG (CD74) Human qPCR Primer Pair (NM_004355)

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF405S conjugate, 0.1mg/mL
BNC042745-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details