Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDR2L Peptide - C-terminal region

CDR2L Peptide - C-terminal region

Product Specifications

Product Name Alternative

HUMPPA

UniProt

Q86X02

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDR2L Rabbit Polyclonal Antibody (orb324524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055418

Preservative

Lyophilized powder

AA Sequence

VQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fam229b activation kit by CRISPRa
GA206716 1 Kit

Mouse Fam229b activation kit by CRISPRa

Sign In for Pricing
View Details
Human IL20 Receptor alpha (IL20RA) activation kit by CRISPRa
GA110029 1 Kit

Human IL20 Receptor alpha (IL20RA) activation kit by CRISPRa

Sign In for Pricing
View Details
KRT75 Human Gene Knockout Kit (CRISPR)
KN424877 1 Kit

KRT75 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-Phenyl-2-thiouracil
TRC-P337105-250MG 250 mg

6-Phenyl-2-thiouracil

Sign In for Pricing
View Details
Human C20orf31 (EDEM2) activation kit by CRISPRa
GA110928 1 Kit

Human C20orf31 (EDEM2) activation kit by CRISPRa

Sign In for Pricing
View Details
Ptgdr Mouse Gene Knockout Kit (CRISPR)
KN514166 1 Kit

Ptgdr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details