Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdx1 Peptide - C-terminal region

Cdx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cdx, Cdx-1

UniProt

P18111

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdx1 Rabbit Polyclonal Antibody (orb576516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034010

Preservative

Lyophilized powder

AA Sequence

ERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSGPPLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Oleate
TRC-S960140-5G 5 g

Sodium Oleate

Sign In for Pricing
View Details
Progesterone Receptor (PGR) (C-term) Mouse Monoclonal Antibody [Clone ID: PR-6A]
AM21049PU-N 100 µg

Progesterone Receptor (PGR) (C-term) Mouse Monoclonal Antibody [Clone ID: PR-6A]

Sign In for Pricing
View Details
TLE4 Human Gene Knockout Kit (CRISPR)
KN420536 1 Kit

TLE4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nudifloramide-d3
TRC-N925502-25MG 25 mg

Nudifloramide-d3

Sign In for Pricing
View Details
SERTAD1 (NM_013376) Human Over-expression Lysate
LC402253 20 µg

SERTAD1 (NM_013376) Human Over-expression Lysate

Sign In for Pricing
View Details
IL36B 153 a.a. Human
OM296388-01 10 µg

IL36B 153 a.a. Human

Sign In for Pricing
View Details