Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdx1 Peptide - C-terminal region

Cdx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cdx, Cdx-1

UniProt

P18111

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdx1 Rabbit Polyclonal Antibody (orb576516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034010

Preservative

Lyophilized powder

AA Sequence

ERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSGPPLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arginyl tRNA synthetase (RARS) Human Gene Knockout Kit (CRISPR)
KN401261 1 Kit

Arginyl tRNA synthetase (RARS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706333 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708243 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Anti-ATP6B
Y058294 100 µL

Anti-ATP6B

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF647 conjugate, 0.1mg/mL
BNC472837-100 1x 100 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HOXA7 Antibody
8C10524-AAT 50 µg

HOXA7 Antibody

Sign In for Pricing
View Details