Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDX1 Peptide - N-terminal region

CDX1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC116915

UniProt

P47902

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDX1 Rabbit Polyclonal Antibody (orb576515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001795

Preservative

Lyophilized powder

AA Sequence

GPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospholipase A2/PLA2G4A Antibody Picoband® (FITC Conjugate)
PB9778-FITC 100 µg/Vial

Anti-Phospholipase A2/PLA2G4A Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
MTA1 Antibody [F4J14]
C18474-100uL*2 2x 100μL

MTA1 Antibody [F4J14]

Sign In for Pricing
View Details
luciferase (Renilla), HEK293 stable cells (Puromycin)
SC020-Puro 2x 10^6 Cell/mL - 1 mL

luciferase (Renilla), HEK293 stable cells (Puromycin)

Sign In for Pricing
View Details
ST6 Sialyltransferase 4
HY-E70152-01 1 mg

ST6 Sialyltransferase 4

Sign In for Pricing
View Details
ST6 Sialyltransferase 4
HY-E70152-02 100 µg

ST6 Sialyltransferase 4

Sign In for Pricing
View Details
ST6 Sialyltransferase 4
HY-E70152-03 20 µg

ST6 Sialyltransferase 4

Sign In for Pricing
View Details