Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDX1 Peptide - N-terminal region

CDX1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC116915

UniProt

P47902

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDX1 Rabbit Polyclonal Antibody (orb576515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001795

Preservative

Lyophilized powder

AA Sequence

GPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Angiopoietin 2 (ANGPT2)
TRV-0053890-01 20 µL

Polyclonal Antibody to Angiopoietin 2 (ANGPT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Angiopoietin 2 (ANGPT2)
TRV-0053890-02 100 µL

Polyclonal Antibody to Angiopoietin 2 (ANGPT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Angiopoietin 2 (ANGPT2)
TRV-0053890-03 200 µL

Polyclonal Antibody to Angiopoietin 2 (ANGPT2)

Sign In for Pricing
View Details
Polyclonal Antibody to Angiopoietin 2 (ANGPT2)
TRV-0053890-04 1 mL

Polyclonal Antibody to Angiopoietin 2 (ANGPT2)

Sign In for Pricing
View Details
Lentiviral mouse Tmem62 shRNA (UAS) - Lentiviral mouse Tmem62 shRNA (UAS, iRFP) (25)
GTR15219146 1 Vial

Lentiviral mouse Tmem62 shRNA (UAS) - Lentiviral mouse Tmem62 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant Rat Ephrin-A1 (Efna1)
orb1653123-01 20 µg

Recombinant Rat Ephrin-A1 (Efna1)

Sign In for Pricing
View Details