Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM3 Peptide - C-terminal region

CEACAM3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD66D, CEA, CGM1, MGC119875, W264, W282

UniProt

P40198

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEACAM3 Rabbit Polyclonal Antibody (orb584574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001806

Preservative

Lyophilized powder

AA Sequence

AKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iso-Valeraldehyde-D7
TRC-V091303-1MG 1 mg

iso-Valeraldehyde-D7

Sign In for Pricing
View Details
Progesterone (6-5E-3F), CF647 conjugate, 0.1mg/mL
BNC470236-500 1x 500 µL

Progesterone (6-5E-3F), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tceal1 (NM_146236) Mouse Tagged ORF Clone
MG201331 10 µg

Tceal1 (NM_146236) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
EC 313
TRC-E335120-100MG 100 mg

EC 313

Sign In for Pricing
View Details
IFITM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]
TA811626BM 100 µL

IFITM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]

Sign In for Pricing
View Details
Caspase-1 Antibody
KC-40238-01 50 μL

Caspase-1 Antibody

Sign In for Pricing
View Details