Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM3 Peptide - C-terminal region

CEACAM3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD66D, CEA, CGM1, MGC119875, W264, W282

UniProt

P40198

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEACAM3 Rabbit Polyclonal Antibody (orb584574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001806

Preservative

Lyophilized powder

AA Sequence

AKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Resistin Recombinant Rabbit monoclonal Antibody
HA723661 100 µL

Human Resistin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HLA-DRB (LN-3 + HLA-DRB/1067), CF488A conjugate, 0.1mg/mL
BNC881208-100 1x 100 µL

HLA-DRB (LN-3 + HLA-DRB/1067), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p-Cresol
TRC-C781900-50G 50 g

p-Cresol

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS700507 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
PITPNB Polyclonal Antibody
E-AB-52589-01 20 µL

PITPNB Polyclonal Antibody

Sign In for Pricing
View Details
PITPNB Polyclonal Antibody
E-AB-52589-02 60 µL

PITPNB Polyclonal Antibody

Sign In for Pricing
View Details