Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7 Peptide - N-terminal region

CEACAM7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CEA, CGM2

UniProt

Q14002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEACAM7 Rabbit Polyclonal Antibody (orb584575) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008821

Preservative

Lyophilized powder

AA Sequence

NLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELF3 (N-term) Rabbit Polyclonal Antibody
AP54327PU-N 400 µL

CELF3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Purified Anti-Human CD194 Antibody[L291H4]
E-AB-F1366A-01 25 µg

Purified Anti-Human CD194 Antibody[L291H4]

Sign In for Pricing
View Details
Purified Anti-Human CD194 Antibody[L291H4]
E-AB-F1366A-02 100 µg

Purified Anti-Human CD194 Antibody[L291H4]

Sign In for Pricing
View Details
PKIB (NM_181794) Human Recombinant Protein
TP316291 20 µg

PKIB (NM_181794) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse PRLR/Prolactin Receptor Protein (Fc Tag)
PKSM041287-01 10 µg

Recombinant Mouse PRLR/Prolactin Receptor Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse PRLR/Prolactin Receptor Protein (Fc Tag)
PKSM041287-02 50 µg

Recombinant Mouse PRLR/Prolactin Receptor Protein (Fc Tag)

Sign In for Pricing
View Details