Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7 Peptide - N-terminal region

CEACAM7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CEA, CGM2

UniProt

Q14002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEACAM7 Rabbit Polyclonal Antibody (orb584575) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008821

Preservative

Lyophilized powder

AA Sequence

NLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3S,4R)-Cabastine Cyclohexyl Carboxamide
TRC-L237330-10MG 10 mg

(3S,4R)-Cabastine Cyclohexyl Carboxamide

Sign In for Pricing
View Details
Human TMPRSS7 activation kit by CRISPRa
GA117597 1 Kit

Human TMPRSS7 activation kit by CRISPRa

Sign In for Pricing
View Details
DLL1 Polyclonal Antibody
E-AB-70187-01 60 µL

DLL1 Polyclonal Antibody

Sign In for Pricing
View Details
DLL1 Polyclonal Antibody
E-AB-70187-02 120 µL

DLL1 Polyclonal Antibody

Sign In for Pricing
View Details
DLL1 Polyclonal Antibody
E-AB-70187-03 200 µL

DLL1 Polyclonal Antibody

Sign In for Pricing
View Details
PLPP6 Human Gene Knockout Kit (CRISPR)
KN206112BN 1 Kit

PLPP6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details