Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7 Peptide - C-terminal region

CEACAM7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CEA, CGM2

UniProt

Q14002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEACAM7 Rabbit Polyclonal Antibody (orb584576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008821

Preservative

Lyophilized powder

AA Sequence

FSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human BCHE Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 120UL
IRBAMLBCHEAAP53120UL 120 µL

Rabbit Anti Human BCHE Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 120UL

Sign In for Pricing
View Details
Zinc Finger Protein 71 (ZNF71) Antibody
abx311845-01 20 µg

Zinc Finger Protein 71 (ZNF71) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 71 (ZNF71) Antibody
abx311845-02 50 µg

Zinc Finger Protein 71 (ZNF71) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 71 (ZNF71) Antibody
abx311845-03 100 µg

Zinc Finger Protein 71 (ZNF71) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 71 (ZNF71) Antibody
abx311845-04 200 µg

Zinc Finger Protein 71 (ZNF71) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein 71 (ZNF71) Antibody
abx311845-05 1 mg

Zinc Finger Protein 71 (ZNF71) Antibody

Sign In for Pricing
View Details