Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7 Peptide - C-terminal region

CEACAM7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CEA, CGM2

UniProt

Q14002

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEACAM7 Rabbit Polyclonal Antibody (orb584576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008821

Preservative

Lyophilized powder

AA Sequence

FSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CTR9 Antibody [Alexa Fluor 700]
NBP2-97398AF700 0.1 mL

Rabbit Polyclonal CTR9 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
(2,4-difluoro-3-isopropoxyphenyl) (methyl) sulfane
PC1026667-01 250 mg

(2,4-difluoro-3-isopropoxyphenyl) (methyl) sulfane

Sign In for Pricing
View Details
(2,4-difluoro-3-isopropoxyphenyl) (methyl) sulfane
PC1026667-02 500 mg

(2,4-difluoro-3-isopropoxyphenyl) (methyl) sulfane

Sign In for Pricing
View Details
12,13-dihydroxy-12-methyltetradecanoic acid
orb3170607-01 1 mg

12,13-dihydroxy-12-methyltetradecanoic acid

Sign In for Pricing
View Details
12,13-dihydroxy-12-methyltetradecanoic acid
orb3170607-02 2 mg

12,13-dihydroxy-12-methyltetradecanoic acid

Sign In for Pricing
View Details
12,13-dihydroxy-12-methyltetradecanoic acid
orb3170607-03 3 mg

12,13-dihydroxy-12-methyltetradecanoic acid

Sign In for Pricing
View Details