CENPN Peptide - middle region
CENPN Peptide - middle region
Product Specifications
Product Name Alternative
BM039, C16orf60, CENP-N, FLJ13607, FLJ22660
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CENPN Rabbit Polyclonal Antibody (orb583496) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IF, WB
NCBI Accession Number
NP_001094095
Preservative
Lyophilized powder
AA Sequence
SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15282157 1 Vial
Lentiviral mouse Spi1 shRNA (UAS) - Lentiviral mouse Spi1 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 
037135-Biotin 200 µL
ITGA5, CT (ITGA5, FNRA, Integrin alpha-5, CD49 antigen-like family member E, Fibronectin receptor subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 heavy chain, Integrin alpha-5 light chain) (Biotin) discontinued
Sign In for Pricing
View Details