Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPV Peptide - C-terminal region

CENPV Peptide - C-terminal region

Product Specifications

Product Name Alternative

3110013H01Rik, CENP-V, PRR6, p30

UniProt

Q7Z7K6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CENPV Rabbit Polyclonal Antibody (orb331199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859067

Preservative

Lyophilized powder

AA Sequence

YTPRSNPGGFGIAPHCLDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCOLCE (NM_002593) Human Mass Spec Standard
PH300515 10 µg

PCOLCE (NM_002593) Human Mass Spec Standard

Sign In for Pricing
View Details
Human XKRY activation kit by CRISPRa
GA106043 1 Kit

Human XKRY activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-MEK-4 antibody
STJ94084 200 µl

Anti-MEK-4 antibody

Sign In for Pricing
View Details
Spark Blue™ 550 anti-mouse/human CD11b
GT00403 25 µg

Spark Blue™ 550 anti-mouse/human CD11b

Sign In for Pricing
View Details
Mouse Creatine kinase MT 1B ELISA Kit (Colorimetric)
NBP2-75317 1 Kit

Mouse Creatine kinase MT 1B ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Mouse Interleukin 3 Chemiluminescent Immunoassay Kit
IMSIL3KTC 1 Each

Mouse Interleukin 3 Chemiluminescent Immunoassay Kit

Sign In for Pricing
View Details