CENPV Peptide - C-terminal region
CENPV Peptide - C-terminal region
Product Specifications
Product Name Alternative
3110013H01Rik, CENP-V, PRR6, p30
UniProt
Q7Z7K6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CENPV Rabbit Polyclonal Antibody (orb331199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_859067
Preservative
Lyophilized powder
AA Sequence
YTPRSNPGGFGIAPHCLDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6384362-01 0.1 mL
LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (MaxLight 49
Sign In for Pricing
View Details MBS6384362-02 5x 0.1 mL
LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (MaxLight 49
Sign In for Pricing
View Details 
