Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Centa1 Peptide - C-terminal region

Centa1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4930431P11Rik, Centa1, GC1L, p42IP4

UniProt

Q8BVR8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Centa1 Rabbit Polyclonal Antibody (orb325726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766311

Preservative

Lyophilized powder

AA Sequence

ARFHYLQVAFPGASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYCBP Rabbit Polyclonal Antibody
TA378820 100 µL

MYCBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GSR Polyclonal Antibody
E-AB-10354-01 20 µL

GSR Polyclonal Antibody

Sign In for Pricing
View Details
GSR Polyclonal Antibody
E-AB-10354-02 60 µL

GSR Polyclonal Antibody

Sign In for Pricing
View Details
GSR Polyclonal Antibody
E-AB-10354-03 120 µL

GSR Polyclonal Antibody

Sign In for Pricing
View Details
GSR Polyclonal Antibody
E-AB-10354-04 200 µL

GSR Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09753T-01 25 µg

Elab Fluor® Violet 610 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details