Centa1 Peptide - C-terminal region
Centa1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
4930431P11Rik, Centa1, GC1L, p42IP4
UniProt
Q8BVR8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Centa1 Rabbit Polyclonal Antibody (orb325726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_766311
Preservative
Lyophilized powder
AA Sequence
ARFHYLQVAFPGASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741604-100 1x 100 µL
CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882968-500 1x 500 µL
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
#20213 1x 250 µL
CF®640R Monoclonal Mouse Anti-Fluorescein (FITC) IgG, 2 mg/mL
Sign In for Pricing
View Details