CEP76 Peptide - middle region
CEP76 Peptide - middle region
Product Specifications
Product Name Alternative
C18orf9, FLJ12542, HsT1705
UniProt
Q8TAP6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CEP76 Rabbit Polyclonal Antibody (orb585385) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079175
Preservative
Lyophilized powder
AA Sequence
SVGILNIKLEMYPPLNQTLSQEVVNTQLALERQKTAEKERLFLVYAKQWW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6396852-01 0.1 mL
TNS4 (Tensin-4, C-terminal Tensin-like Protein, CTEN, PP14434) (AP)
Sign In for Pricing
View Details MBS6396852-02 5x 0.1 mL
TNS4 (Tensin-4, C-terminal Tensin-like Protein, CTEN, PP14434) (AP)
Sign In for Pricing
View Details IS100A8RLY100UG 100 µg
S100A8 Recombinant Protein Tag Free Lyophilized 100UG
Sign In for Pricing
View Details