Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP76 Peptide - middle region

CEP76 Peptide - middle region

Product Specifications

Product Name Alternative

C18orf9, FLJ12542, HsT1705

UniProt

Q8TAP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP76 Rabbit Polyclonal Antibody (orb585385) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079175

Preservative

Lyophilized powder

AA Sequence

SVGILNIKLEMYPPLNQTLSQEVVNTQLALERQKTAEKERLFLVYAKQWW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEAN1 Human Gene Knockout Kit (CRISPR)
KN427848 1 Kit

BEAN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Serine/threonine-protein kinase US3 Rabbit pAb
ES13148-01 50 µL

Serine/threonine-protein kinase US3 Rabbit pAb

Sign In for Pricing
View Details
Serine/threonine-protein kinase US3 Rabbit pAb
ES13148-02 100 µL

Serine/threonine-protein kinase US3 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human EGF Protein
TL-613-0010 10 µg

Recombinant Human EGF Protein

Sign In for Pricing
View Details
Olr295 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7299506 1.0 µg DNA

Olr295 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human NDNF Protein Lysate
MBS8415857-01 0.02 mg

Human NDNF Protein Lysate

Sign In for Pricing
View Details