Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CERKL Peptide - C-terminal region

CERKL Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP26

UniProt

Q49MI3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CERKL Rabbit Polyclonal Antibody (orb584475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025484

Preservative

Lyophilized powder

AA Sequence

ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT15 (NM_018283) Human Over-expression Lysate
LC402670 20 µg

NUDT15 (NM_018283) Human Over-expression Lysate

Sign In for Pricing
View Details
CellBrite® Steady 594 Membrane Staining Kit, 100 Labelings
#30142-T 1 Kit

CellBrite® Steady 594 Membrane Staining Kit, 100 Labelings

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), 0.2mg/mL
BNUB2179-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), 0.2mg/mL

Sign In for Pricing
View Details
ARK5 (NUAK1) Human Gene Knockout Kit (CRISPR)
KN219282LP 1 Kit

ARK5 (NUAK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cell Meter™ Caspase 3/7 Activity Apoptosis Assay Kit *Red Fluorescence*
22797-AAT 100 Tests

Cell Meter™ Caspase 3/7 Activity Apoptosis Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
WAY 127039-A-1 Sodium Salt
TRC-W498700-50MG 50 mg

WAY 127039-A-1 Sodium Salt

Sign In for Pricing
View Details