Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CERKL Peptide - C-terminal region

CERKL Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP26

UniProt

Q49MI3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CERKL Rabbit Polyclonal Antibody (orb584475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025484

Preservative

Lyophilized powder

AA Sequence

ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAALAD2 Human Gene Knockout Kit (CRISPR)
KN419582 1 Kit

NAALAD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
bcl 6 (BCL6) Mouse Monoclonal Antibody [Clone ID: OTI8H3]
CF813918 100 µg

bcl 6 (BCL6) Mouse Monoclonal Antibody [Clone ID: OTI8H3]

Sign In for Pricing
View Details
Propionaldehyde
TRC-P782500-5G 5 g

Propionaldehyde

Sign In for Pricing
View Details
Datura Stramonium Lectin (DSL), Biotin Conjugate
#29096 1x 1 mL

Datura Stramonium Lectin (DSL), Biotin Conjugate

Sign In for Pricing
View Details
Neuropilin 1 (NRP1) Human Gene Knockout Kit (CRISPR)
KN202952BN 1 Kit

Neuropilin 1 (NRP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lithium Perchlorate
TRC-L469270-5G 5 g

Lithium Perchlorate

Sign In for Pricing
View Details