Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES3 Peptide - C-terminal region

CES3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ES31, FLJ21736

UniProt

Q6UWW8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CES3 Rabbit Polyclonal Antibody (orb585194) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079198

Preservative

Lyophilized powder

AA Sequence

QAEQYLEINPVPRAGQKFREAWMQFWSETLPSKIQQWHQKQKNRKAQEDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosine Hydroxylase (TH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D8]
TA506553AM 100 µL

Tyrosine Hydroxylase (TH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D8]

Sign In for Pricing
View Details
6α-Naltrexol (1.0mg/ml in Acetonitrile)
TRC-KIT6425-1X1ML 1 mL

6α-Naltrexol (1.0mg/ml in Acetonitrile)

Sign In for Pricing
View Details
XCL1 Antibody (Biotin)
KB-8295-01 50 μL

XCL1 Antibody (Biotin)

Sign In for Pricing
View Details
XCL1 Antibody (Biotin)
KB-8295-02 100 µL

XCL1 Antibody (Biotin)

Sign In for Pricing
View Details
XCL1 Antibody (Biotin)
KB-8295-03 1 mL

XCL1 Antibody (Biotin)

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), 1mg/mL
BNUM1778-50 1x 50 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), 1mg/mL

Sign In for Pricing
View Details