Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES3 Peptide - C-terminal region

CES3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ES31, FLJ21736

UniProt

Q6UWW8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CES3 Rabbit Polyclonal Antibody (orb585194) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079198

Preservative

Lyophilized powder

AA Sequence

QAEQYLEINPVPRAGQKFREAWMQFWSETLPSKIQQWHQKQKNRKAQEDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC43 (NM_001098519) Human Over-expression Lysate
LY420617 100 µg

LRRC43 (NM_001098519) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Aminoindan
TRC-A610655-500MG 500 mg

4-Aminoindan

Sign In for Pricing
View Details
Recombinant Beta Amyloid Antibody
RC-4414-01 50 μL

Recombinant Beta Amyloid Antibody

Sign In for Pricing
View Details
Recombinant Beta Amyloid Antibody
RC-4414-02 100 µL

Recombinant Beta Amyloid Antibody

Sign In for Pricing
View Details
Recombinant Beta Amyloid Antibody
RC-4414-03 1 mL

Recombinant Beta Amyloid Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559794 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details