Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFD Peptide - C-terminal region

CFD Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADIPSIN, ADN, DF, PFD

UniProt

P00746

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFD Rabbit Polyclonal Antibody (orb584602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001919

Preservative

Lyophilized powder

AA Sequence

GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Growth and Differentiation factor 11, His Tag
MBS141087-01 0.005 mg

Recombinant Human Growth and Differentiation factor 11, His Tag

Sign In for Pricing
View Details
Recombinant Human Growth and Differentiation factor 11, His Tag
MBS141087-02 0.02 mg

Recombinant Human Growth and Differentiation factor 11, His Tag

Sign In for Pricing
View Details
Recombinant Human Growth and Differentiation factor 11, His Tag
MBS141087-03 1 mg

Recombinant Human Growth and Differentiation factor 11, His Tag

Sign In for Pricing
View Details
Recombinant Human Growth and Differentiation factor 11, His Tag
MBS141087-04 5x 1 mg

Recombinant Human Growth and Differentiation factor 11, His Tag

Sign In for Pricing
View Details
MYCNOS Protein Vector (Human) (pPB-C-His)
PV103050 500 ng

MYCNOS Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Dihydrojasmonic acid
orb1690581 50 mg

Dihydrojasmonic acid

Sign In for Pricing
View Details