CFDP1 Peptide - middle region
CFDP1 Peptide - middle region
Product Specifications
Product Name Alternative
BCNT, CP27, SWC5, Yeti, p97, CENP-29, BUCENTAUR
UniProt
Q9UEE9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CFDP1 Rabbit Polyclonal Antibody (orb581589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006315
Preservative
Lyophilized powder
AA Sequence
GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400012-100 1x 100 µL
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401602-100 1x 100 µL
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details