Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD1 Peptide - N-terminal region

CHCHD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C10orf34, C2360, FLJ25854

UniProt

Q96BP2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHCHD1 Rabbit Polyclonal Antibody (orb582097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976043

Preservative

Lyophilized powder

AA Sequence

MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG5 Rabbit Polyclonal Antibody
TA324633 400 µL

ATG5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Autophagy-Related Protein 2 Homolog A (ATG2A) Antibody (ATTO 565)
abx447064 100 µg

Autophagy-Related Protein 2 Homolog A (ATG2A) Antibody (ATTO 565)

Sign In for Pricing
View Details
L-type Ca++ CP γ2 Double Nickase Plasmid (h)
sc-411463-NIC 20 µg

L-type Ca++ CP γ2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
SYT10 Recombinant Protein (Rat)
RP231965 100 µg

SYT10 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Parvalbumin Beta Polyclonal Antibody, FITC Conjugated
A55152-100 100 µL

Parvalbumin Beta Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
MYOD1 Antibody
E51A09634 100 µL

MYOD1 Antibody

Sign In for Pricing
View Details