Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD1 Peptide - N-terminal region

CHCHD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C10orf34, C2360, FLJ25854

UniProt

Q96BP2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHCHD1 Rabbit Polyclonal Antibody (orb582097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976043

Preservative

Lyophilized powder

AA Sequence

MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hs6st2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3661704 1.0 µg DNA

Hs6st2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human OR52A1 Pre-designed siRNA Set A
SI011316A 1 Each

Human OR52A1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS609693 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
CY 208-243
orb1709966-01 25 mg

CY 208-243

Sign In for Pricing
View Details
CY 208-243
orb1709966-02 50 mg

CY 208-243

Sign In for Pricing
View Details
CY 208-243
orb1709966-03 100 mg

CY 208-243

Sign In for Pricing
View Details