CHCHD8 Peptide - middle region
CHCHD8 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp762H1711, E2IG2, MGC117206, CHCHD8
UniProt
Q9NYJ1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CHCHD8 Rabbit Polyclonal Antibody (orb583377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057649
Preservative
Lyophilized powder
AA Sequence
SHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEELQRRQEQAGAH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![4-Amino-N-{3-[ (dimethylamino) methyl]phenyl}-1,2,5-oxadiazole-3-carboxamide](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
LCC31430-01 50 mg
4-Amino-N-{3-[ (dimethylamino) methyl]phenyl}-1,2,5-oxadiazole-3-carboxamide
Sign In for Pricing
View Details LCC31430-02 0.5 g
4-Amino-N-{3-[ (dimethylamino) methyl]phenyl}-1,2,5-oxadiazole-3-carboxamide
Sign In for Pricing
View Details 
bsm-61058R-Biotin-01 20 µL
IRAK Recombinant Antibody, Biotin Conjugated
Sign In for Pricing
View Details bsm-61058R-Biotin-02 100 µL
IRAK Recombinant Antibody, Biotin Conjugated
Sign In for Pricing
View Details