Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHI3L2 Peptide - N-terminal region

CHI3L2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

YKL-39, YKL39

UniProt

Q15782

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHI3L2 Rabbit Polyclonal Antibody (orb585265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003991

Preservative

Lyophilized powder

AA Sequence

WSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT12 Mouse Monoclonal Antibody [Clone ID: OTI5B6]
CF805570 100 µg

NUDT12 Mouse Monoclonal Antibody [Clone ID: OTI5B6]

Sign In for Pricing
View Details
Purified Anti-Human IL-2 Antibody[MQ1-17H12]
E-AB-F1200A-01 25 µg

Purified Anti-Human IL-2 Antibody[MQ1-17H12]

Sign In for Pricing
View Details
Purified Anti-Human IL-2 Antibody[MQ1-17H12]
E-AB-F1200A-02 100 µg

Purified Anti-Human IL-2 Antibody[MQ1-17H12]

Sign In for Pricing
View Details
Human GOLGA8G activation kit by CRISPRa
GA117058 1 Kit

Human GOLGA8G activation kit by CRISPRa

Sign In for Pricing
View Details
AHNAK Human Gene Knockout Kit (CRISPR)
KN415337 1 Kit

AHNAK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(3R,4S,5S)-4-Hydroxy-3-(pentan-3-yloxy)-5-(tosyloxy)cyclohex-1-enecarboxylic Acid
TRC-H939990-25MG 25 mg

(3R,4S,5S)-4-Hydroxy-3-(pentan-3-yloxy)-5-(tosyloxy)cyclohex-1-enecarboxylic Acid

Sign In for Pricing
View Details