CHI3L2 Peptide - N-terminal region
CHI3L2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
YKL-39, YKL39
UniProt
Q15782
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CHI3L2 Rabbit Polyclonal Antibody (orb585265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003991
Preservative
Lyophilized powder
AA Sequence
WSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-D415082-5MG 5 mg
(R)-2,4-Diamino-Butanoic acid Dihydrochloride-d3 (major)
Sign In for Pricing
View Details ![beta II Tubulin (TUBB2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E6]](https://cdn.genprice.uk/products/937/6868c383994c49e6dc3f8344/imageurl/ta506590bm.webp)
TA506590BM 100 µL
beta II Tubulin (TUBB2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E6]
Sign In for Pricing
View Details 
BSH100-02 1 Each
Block, 40 x 0.2ml tubes or 5 PCR strips of 8 tubes each
Sign In for Pricing
View Details 