CHI3L2 Peptide - middle region
CHI3L2 Peptide - middle region
Product Specifications
Product Name Alternative
YKL-39, YKL39
UniProt
Q15782
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CHI3L2 Rabbit Polyclonal Antibody (orb585266) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003991
Preservative
Lyophilized powder
AA Sequence
LDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTAGVSAGRQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M9800-80B-AP 200 µL
MYT1, CT (Membrane-associated Tyrosine-and Threonine-specific cdc2-inhibitory Kinase, Myt1 Kinase, PKMYT1) (AP) discontinued
Sign In for Pricing
View Details 
039673-ML550 100 µL
PARP1, phosphorylated (S782) (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD (+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 550) discontinued
Sign In for Pricing
View Details 
