Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHI3L2 Peptide - middle region

CHI3L2 Peptide - middle region

Product Specifications

Product Name Alternative

YKL-39, YKL39

UniProt

Q15782

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHI3L2 Rabbit Polyclonal Antibody (orb585266) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003991

Preservative

Lyophilized powder

AA Sequence

LDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTAGVSAGRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPP1 3'UTR Lenti-reporter-Luc Vector
49221081 1.0 µg

UPP1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Glycyl-H 1152 dihydrochloride
FG23695-01 1 mg

Glycyl-H 1152 dihydrochloride

Sign In for Pricing
View Details
Glycyl-H 1152 dihydrochloride
FG23695-02 2 mg

Glycyl-H 1152 dihydrochloride

Sign In for Pricing
View Details
Glycyl-H 1152 dihydrochloride
FG23695-03 5 mg

Glycyl-H 1152 dihydrochloride

Sign In for Pricing
View Details
Glycyl-H 1152 dihydrochloride
FG23695-04 10 mg

Glycyl-H 1152 dihydrochloride

Sign In for Pricing
View Details
TLK1P1 Protein Vector (Human) (pPM-C-HA)
46762021 500 ng

TLK1P1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details