Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHMP1B Peptide - N-terminal region

CHMP1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

C10orf2, C18-ORF2, C18orf2, CHMP1.5, Vps46-2, Vps46B, hVps46-2

UniProt

Q7LBR1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHMP1B Rabbit Polyclonal Antibody (orb583555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065145

Preservative

Lyophilized powder

AA Sequence

KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VWDE (NM_001135924) Human Over-expression Lysate
LY427732 100 µg

VWDE (NM_001135924) Human Over-expression Lysate

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR450), CF405S conjugate, 0.1mg/mL
BNC040450-500 1x 500 µL

EGFR (GFR450), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Avacopan
TRC-A245770-100MG 100 mg

Avacopan

Sign In for Pricing
View Details
Biotinylated Anti-SARS-CoV-2 Spike RBD Antibody, Chimeric mAb, Human IgG1 (AM130) (MALS verified)
SPD-BM227-200ug 200 µg

Biotinylated Anti-SARS-CoV-2 Spike RBD Antibody, Chimeric mAb, Human IgG1 (AM130) (MALS verified)

Sign In for Pricing
View Details
Human Hsc70 (HSPA8) activation kit by CRISPRa
GA102263 1 Kit

Human Hsc70 (HSPA8) activation kit by CRISPRa

Sign In for Pricing
View Details