CHMP4B Peptide - middle region
CHMP4B Peptide - middle region
Product Specifications
Product Name Alternative
C20orf178, CHMP4A, CTPP3, SNF7, SNF7-2, Shax1, dJ553F4.4, VPS32B, Vps32-2
UniProt
Q9H444
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CHMP4B Rabbit Polyclonal Antibody (orb582036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_789782
Preservative
Lyophilized powder
AA Sequence
RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
QP8930-ec-500ug 500ug
Recombinant Chicken Tubulin beta-1 chain Protein, His, E.coli-500ug
Sign In for Pricing
View Details MBS1059967-01 0.02 mg (E-Coli)
Recombinant Staphylococcus aureus HPr kinase/phosphorylase (hprK)
Sign In for Pricing
View Details MBS1059967-02 0.02 mg (Yeast)
Recombinant Staphylococcus aureus HPr kinase/phosphorylase (hprK)
Sign In for Pricing
View Details MBS1059967-03 0.1 mg (E-Coli)
Recombinant Staphylococcus aureus HPr kinase/phosphorylase (hprK)
Sign In for Pricing
View Details MBS1059967-04 0.1 mg (Yeast)
Recombinant Staphylococcus aureus HPr kinase/phosphorylase (hprK)
Sign In for Pricing
View Details