Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHMP4B Peptide - middle region

CHMP4B Peptide - middle region

Product Specifications

Product Name Alternative

C20orf178, CHMP4A, CTPP3, SNF7, SNF7-2, Shax1, dJ553F4.4, VPS32B, Vps32-2

UniProt

Q9H444

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHMP4B Rabbit Polyclonal Antibody (orb582037) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789782

Preservative

Lyophilized powder

AA Sequence

EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit
abx359276 96 Well

Monkey Oncoprotein Induced Transcript 3 (OIT3) ELISA Kit

Sign In for Pricing
View Details
TMC2 (NM_080751) Human Untagged Clone
SC318378 10 µg

TMC2 (NM_080751) Human Untagged Clone

Sign In for Pricing
View Details
Goat Endomorphin 2 ELISA kit
GTR10468324 96 Well

Goat Endomorphin 2 ELISA kit

Sign In for Pricing
View Details
Atp8b4 3'UTR Lenti-reporter-Luc Vector
12821084 1.0 µg

Atp8b4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CTSS sgRNA CRISPR Lentivector (Human) (Target 1)
K0530902 1.0 µg DNA

CTSS sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ACD Polyclonal Antibody
E912177 100 µL

ACD Polyclonal Antibody

Sign In for Pricing
View Details