Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHMP4B Peptide - middle region

CHMP4B Peptide - middle region

Product Specifications

Product Name Alternative

C20orf178, CHMP4A, CTPP3, SNF7, SNF7-2, Shax1, dJ553F4.4, VPS32B, Vps32-2

UniProt

Q9H444

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHMP4B Rabbit Polyclonal Antibody (orb582037) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789782

Preservative

Lyophilized powder

AA Sequence

EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISYNA1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1102502 1.0 µg DNA

ISYNA1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
KLHDC8A Rabbit Polyclonal Antibody (FITC)
orb2124702 100 µL

KLHDC8A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
RAB24 (Ras-Related Protein Rab-24) discontinued
345523-01 100 µL

RAB24 (Ras-Related Protein Rab-24) discontinued

Sign In for Pricing
View Details
RAB24 (Ras-Related Protein Rab-24) discontinued
345523-02 200 µL

RAB24 (Ras-Related Protein Rab-24) discontinued

Sign In for Pricing
View Details
BMPR1A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-1509R-BF350-01 20 µL

BMPR1A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
BMPR1A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-1509R-BF350-02 100 µL

BMPR1A Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details