Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chodl Peptide - C-terminal region

Chodl Peptide - C-terminal region

Product Specifications

Product Name Alternative

3110074E07Rik, MT75, PRED12

UniProt

Q9CXM0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Chodl Rabbit Polyclonal Antibody (orb582224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_624360

Preservative

Lyophilized powder

AA Sequence

YLYQWNDDRCNMKHNYICKYEPEIHPTEPAEKPYLTNQPEETHENVVVTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Carbamoylformimidamide Tritosulfuron
TRC-T886905-10MG 10 mg

N-Carbamoylformimidamide Tritosulfuron

Sign In for Pricing
View Details
CD43 (SPN/1094), CF405S conjugate, 0.1mg/mL
BNC041094-500 1x 500 µL

CD43 (SPN/1094), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pentaerythritol Tris Ester With 3-(3,5-Di-tert-butyl-4-hydroxyphenyl)propionic Acid
TRC-D194295-100MG 100 mg

Pentaerythritol Tris Ester With 3-(3,5-Di-tert-butyl-4-hydroxyphenyl)propionic Acid

Sign In for Pricing
View Details
DMAP1 (NM_001034023) Human Over-expression Lysate
LC421951 20 µg

DMAP1 (NM_001034023) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM90A27P (NM_001195187) Human Over-expression Lysate
LC434245 20 µg

FAM90A27P (NM_001195187) Human Over-expression Lysate

Sign In for Pricing
View Details
PLS1 Antibody
KC-33512-01 50 μL

PLS1 Antibody

Sign In for Pricing
View Details