Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chodl Peptide - C-terminal region

Chodl Peptide - C-terminal region

Product Specifications

Product Name Alternative

3110074E07Rik, MT75, PRED12

UniProt

Q9CXM0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Chodl Rabbit Polyclonal Antibody (orb582224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_624360

Preservative

Lyophilized powder

AA Sequence

YLYQWNDDRCNMKHNYICKYEPEIHPTEPAEKPYLTNQPEETHENVVVTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLU7 Mouse Monoclonal Antibody [Clone ID: OTI3C8]
CF810914 100 µg

SLU7 Mouse Monoclonal Antibody [Clone ID: OTI3C8]

Sign In for Pricing
View Details
LPHN1 Antibody
8G377-AAT 50 µg

LPHN1 Antibody

Sign In for Pricing
View Details
CCDC85B Human Gene Knockout Kit (CRISPR)
KN401086 1 Kit

CCDC85B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(S)-Anabasine, > 98% ee
TRC-A637170-50MG 50 mg

(S)-Anabasine, > 98% ee

Sign In for Pricing
View Details
TTC32 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F4]
TA501340AM 100 µL

TTC32 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F4]

Sign In for Pricing
View Details
ASF1B Mouse Monoclonal Antibody [Clone ID: OTI1H5]
CF813126 100 µg

ASF1B Mouse Monoclonal Antibody [Clone ID: OTI1H5]

Sign In for Pricing
View Details