Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA5 Peptide - middle region

CHRNA5 Peptide - middle region

Product Specifications

Product Name Alternative

LNCR2

UniProt

P30532

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRNA5 Rabbit Polyclonal Antibody (orb575333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000736

Preservative

Lyophilized powder

AA Sequence

PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red Conjugated Goat Polyclonal Antibody to Human Lambda (Free Bence Jones)
TA-2109-2 2 mL

Texas Red Conjugated Goat Polyclonal Antibody to Human Lambda (Free Bence Jones)

Sign In for Pricing
View Details
N-Acetyl-L-cysteine Isopropyl Ester
TRC-A457890-1G 1 g

N-Acetyl-L-cysteine Isopropyl Ester

Sign In for Pricing
View Details
Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit
E-EL-R0589-01 24 Tests

Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit

Sign In for Pricing
View Details
Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit
E-EL-R0589-02 48 Tests

Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit

Sign In for Pricing
View Details
Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit
E-EL-R0589-03 96 Tests

Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit

Sign In for Pricing
View Details
4-(Trifluoroacetylamino)benzoic Acid
TRC-T786745-500MG 500 mg

4-(Trifluoroacetylamino)benzoic Acid

Sign In for Pricing
View Details