Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRND Peptide - N-terminal region

CHRND Peptide - N-terminal region

Product Specifications

Product Name Alternative

ACHRD, CMS2A, FCCMS, SCCMS

UniProt

Q07001

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRND Rabbit Polyclonal Antibody (orb575335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000742

Preservative

Lyophilized powder

AA Sequence

RLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-100 1x 100 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-100 1x 100 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-500 1x 500 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details