Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chst11 Peptide - C-terminal region

Chst11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4ST1, Chst11

UniProt

P69478

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Chst11 Rabbit Polyclonal Antibody (orb580058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101549

Preservative

Lyophilized powder

AA Sequence

FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G1/S-specific cyclin-D2
AP81743 1 mg

G1/S-specific cyclin-D2

Sign In for Pricing
View Details
KV9.2 Polyclonal Antibody
orb1413241 100 µL

KV9.2 Polyclonal Antibody

Sign In for Pricing
View Details
CD3D
pro-2539 2µg

CD3D

Sign In for Pricing
View Details
Porcine Metabotropic glutamate receptor 2 (GRM2) ELISA Kit
MBS7209315-01 48 Well

Porcine Metabotropic glutamate receptor 2 (GRM2) ELISA Kit

Sign In for Pricing
View Details
Porcine Metabotropic glutamate receptor 2 (GRM2) ELISA Kit
MBS7209315-02 96 Well

Porcine Metabotropic glutamate receptor 2 (GRM2) ELISA Kit

Sign In for Pricing
View Details
Porcine Metabotropic glutamate receptor 2 (GRM2) ELISA Kit
MBS7209315-03 5x 96 Well

Porcine Metabotropic glutamate receptor 2 (GRM2) ELISA Kit

Sign In for Pricing
View Details