Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chst11 Peptide - C-terminal region

Chst11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C4ST1, Chst11

UniProt

P69478

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Chst11 Rabbit Polyclonal Antibody (orb580058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101549

Preservative

Lyophilized powder

AA Sequence

FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Alpha linolenic Acid ELISA Kit
MBS7272504-01 48 Well

Chicken Alpha linolenic Acid ELISA Kit

Sign In for Pricing
View Details
Chicken Alpha linolenic Acid ELISA Kit
MBS7272504-02 96 Well

Chicken Alpha linolenic Acid ELISA Kit

Sign In for Pricing
View Details
Chicken Alpha linolenic Acid ELISA Kit
MBS7272504-03 5x 96 Well

Chicken Alpha linolenic Acid ELISA Kit

Sign In for Pricing
View Details
Chicken Alpha linolenic Acid ELISA Kit
MBS7272504-04 10x 96 Well

Chicken Alpha linolenic Acid ELISA Kit

Sign In for Pricing
View Details
NFYC Rabbit Polyclonal Antibody (HRP)
orb2128043 100 µL

NFYC Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Keratin 18 Antibody
MBS8587005-01 0.1 mg

Keratin 18 Antibody

Sign In for Pricing
View Details