Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chst2 Peptide - middle region

Chst2 Peptide - middle region

Product Specifications

Product Name Alternative

AI428561, AW121776, C130041E03Rik, Chts2, GST-2, GlcNAc6ST, Gn6st

UniProt

Q80WV3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Chst2 Rabbit Polyclonal Antibody (orb579784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061233

Preservative

Lyophilized powder

AA Sequence

VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INA Antibody
orb1263902 400 μl

INA Antibody

Sign In for Pricing
View Details
Microtubule/Tubulin In Vivo Assay Biochem Kit
BK038 30 - 100 Assays/Kit

Microtubule/Tubulin In Vivo Assay Biochem Kit

Sign In for Pricing
View Details
CHAPSO
40330028-2 5 g

CHAPSO

Sign In for Pricing
View Details
Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (H7E8) [Alexa Fluor 405]
NB500-532AF405 0.1 mL

Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (H7E8) [Alexa Fluor 405]

Sign In for Pricing
View Details
APC Anti-Human CD8a (OKT8)
orb1215622-01 25 Tests

APC Anti-Human CD8a (OKT8)

Sign In for Pricing
View Details
APC Anti-Human CD8a (OKT8)
orb1215622-02 100 Tests

APC Anti-Human CD8a (OKT8)

Sign In for Pricing
View Details