Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chst2 Peptide - middle region

Chst2 Peptide - middle region

Product Specifications

Product Name Alternative

AI428561, AW121776, C130041E03Rik, Chts2, GST-2, GlcNAc6ST, Gn6st

UniProt

Q80WV3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Chst2 Rabbit Polyclonal Antibody (orb579784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061233

Preservative

Lyophilized powder

AA Sequence

VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
33048124 3x 1.0µg DNA

Olfr3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
DDX18 (FITC)
560167-01 50 µg

DDX18 (FITC)

Sign In for Pricing
View Details
DDX18 (FITC)
560167-02 100 µg

DDX18 (FITC)

Sign In for Pricing
View Details
CD164 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
15475156 3x 1.0 µg DNA

CD164 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Rat SolubleInterleukin 6 Receptor (sIL-6R) ELISA Kit
orb779527-01 48 Tests

Rat SolubleInterleukin 6 Receptor (sIL-6R) ELISA Kit

Sign In for Pricing
View Details
Rat SolubleInterleukin 6 Receptor (sIL-6R) ELISA Kit
orb779527-02 96 Tests

Rat SolubleInterleukin 6 Receptor (sIL-6R) ELISA Kit

Sign In for Pricing
View Details