Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHTF18 Peptide - middle region

CHTF18 Peptide - middle region

Product Specifications

Product Name Alternative

C16orf41, C321D2.2, C321D2.3, C321D2.4, CHL12, Ctf18, RUVBL

UniProt

Q8WVB6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHTF18 Rabbit Polyclonal Antibody (orb583626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071375

Preservative

Lyophilized powder

AA Sequence

SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human Serum Albumin Antibody-Biotin labled
CPA9958-01 30 µL

Anti-Human Serum Albumin Antibody-Biotin labled

Sign In for Pricing
View Details
Anti-Human Serum Albumin Antibody-Biotin labled
CPA9958-02 50 μL

Anti-Human Serum Albumin Antibody-Biotin labled

Sign In for Pricing
View Details
Anti-Human Serum Albumin Antibody-Biotin labled
CPA9958-03 100 µL

Anti-Human Serum Albumin Antibody-Biotin labled

Sign In for Pricing
View Details
Anti-Human Serum Albumin Antibody-Biotin labled
CPA9958-04 200 µL

Anti-Human Serum Albumin Antibody-Biotin labled

Sign In for Pricing
View Details
Rabbit Monoclonal GOLM1 Antibody (005) [Allophycocyanin]
NBP2-90163APC 0.1 mL

Rabbit Monoclonal GOLM1 Antibody (005) [Allophycocyanin]

Sign In for Pricing
View Details
Mouse Dph3 Pre-designed siRNA Set A
SI103863A 1 Each

Mouse Dph3 Pre-designed siRNA Set A

Sign In for Pricing
View Details