Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHTF18 Peptide - middle region

CHTF18 Peptide - middle region

Product Specifications

Product Name Alternative

C16orf41, C321D2.2, C321D2.3, C321D2.4, CHL12, Ctf18, RUVBL

UniProt

Q8WVB6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHTF18 Rabbit Polyclonal Antibody (orb583626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071375

Preservative

Lyophilized powder

AA Sequence

SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Chloride
18-215 2500 g/Unit

Sodium Chloride

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Probable sodium/potassium/calcium exchanger CG1090 (CG1090), partial
MBS7102406 Inquire

Recombinant Drosophila melanogaster Probable sodium/potassium/calcium exchanger CG1090 (CG1090), partial

Sign In for Pricing
View Details
Recombinant USP9X Antibody
RC-15842-01 50 μL

Recombinant USP9X Antibody

Sign In for Pricing
View Details
Recombinant USP9X Antibody
RC-15842-02 100 µL

Recombinant USP9X Antibody

Sign In for Pricing
View Details
Recombinant USP9X Antibody
RC-15842-03 1 mL

Recombinant USP9X Antibody

Sign In for Pricing
View Details
CRBP I shRNA (h) Lentiviral Particles
sc-43699-V 200 µL

CRBP I shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details