Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cish Peptide - N-terminal region

Cish Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI385595, CIS1, Cis, F17, F23

UniProt

Q62225

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cish Rabbit Polyclonal Antibody (orb581837) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034025

Preservative

Lyophilized powder

AA Sequence

RESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcineurin A / PPP3CA (BF1.1), CF405S conjugate, 0.1mg/mL
BNC042283-500 1x 500 µL

Calcineurin A / PPP3CA (BF1.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAP43 pSer41 Rabbit Polyclonal Antibody
AP09476PU-S 50 µL

GAP43 pSer41 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PerCP Anti-Human HLA-DR Antibody[L243]
E-AB-F1111F-01 20 Tests

PerCP Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
PerCP Anti-Human HLA-DR Antibody[L243]
E-AB-F1111F-02 100 Tests

PerCP Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
PerCP Anti-Human HLA-DR Antibody[L243]
E-AB-F1111F-03 2x 100 Tests

PerCP Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
Cis-Anethole
TRC-A653355-500MG 500 mg

Cis-Anethole

Sign In for Pricing
View Details