Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cish Peptide - N-terminal region

Cish Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI385595, CIS1, Cis, F17, F23

UniProt

Q62225

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cish Rabbit Polyclonal Antibody (orb581837) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034025

Preservative

Lyophilized powder

AA Sequence

RESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABRB2 Rabbit Polyclonal Antibody
HA500289 100 µL

GABRB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Muscle tissue
CS701718 5x 5 µm

Tissue FFPE Sections, Muscle tissue

Sign In for Pricing
View Details
8-Hydroxy-14-nitro-10-oxo-8,14-dihydrothebaine
TRC-H948705-25MG 25 mg

8-Hydroxy-14-nitro-10-oxo-8,14-dihydrothebaine

Sign In for Pricing
View Details
BactoViewTM Dead 500/515
#40107 1x 100 µL

BactoViewTM Dead 500/515

Sign In for Pricing
View Details
Histone H3 (acetyl K27) Rabbit Polyclonal Antibody
HA500046 100 µL

Histone H3 (acetyl K27) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ALX3 Rabbit Polyclonal Antibody
AP06648PU-N 100 µg

ALX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details