Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cited4 Peptide - middle region

Cited4 Peptide - middle region

Product Specifications

Product Name Alternative

AU019445, AW742964, Mrg2, MRG-2

UniProt

Q9WUL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cited4 Rabbit Polyclonal Antibody (orb324684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062509

Preservative

Lyophilized powder

AA Sequence

PPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEB4 (NM_002367) Human Over-expression Lysate
LY419379 100 µg

MAGEB4 (NM_002367) Human Over-expression Lysate

Sign In for Pricing
View Details
PE Anti-Mouse CD366/Tim-3 Antibody[RMT3-23]
E-AB-F1192UD-01 25 µg

PE Anti-Mouse CD366/Tim-3 Antibody[RMT3-23]

Sign In for Pricing
View Details
PE Anti-Mouse CD366/Tim-3 Antibody[RMT3-23]
E-AB-F1192UD-02 100 µg

PE Anti-Mouse CD366/Tim-3 Antibody[RMT3-23]

Sign In for Pricing
View Details
3-(3-Pyridinyl)-1-(4-pyridinyl)-2-propen-1-one
TRC-P993045-10MG 10 mg

3-(3-Pyridinyl)-1-(4-pyridinyl)-2-propen-1-one

Sign In for Pricing
View Details
Human LRP2BP activation kit by CRISPRa
GA110984 1 Kit

Human LRP2BP activation kit by CRISPRa

Sign In for Pricing
View Details
SQ 22536
TRC-S683700-50MG 50 mg

SQ 22536

Sign In for Pricing
View Details