Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cited4 Peptide - middle region

Cited4 Peptide - middle region

Product Specifications

Product Name Alternative

AU019445, AW742964, Mrg2, MRG-2

UniProt

Q9WUL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cited4 Rabbit Polyclonal Antibody (orb324684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062509

Preservative

Lyophilized powder

AA Sequence

PPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF568 conjugate, 0.1mg/mL
BNC682993-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant ESE1 Antibody
RC-16229-01 50 μL

Recombinant ESE1 Antibody

Sign In for Pricing
View Details
Recombinant ESE1 Antibody
RC-16229-02 100 µL

Recombinant ESE1 Antibody

Sign In for Pricing
View Details
Recombinant ESE1 Antibody
RC-16229-03 1 mL

Recombinant ESE1 Antibody

Sign In for Pricing
View Details
Direct Blue 71 (Technical Grade)
TRC-D494318-5G 5 g

Direct Blue 71 (Technical Grade)

Sign In for Pricing
View Details
E Cadherin (CDH1) Rabbit Polyclonal Antibody
AP20195PU-N 100 µg

E Cadherin (CDH1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details